About Us
Founded in 1944, the American Committee for the Weizmann Institute of Science develops philanthropic support for the Weizmann Institute in Israel, and advances its mission of science for the future of humanity.
https://weizmann-usa.org/news-media/news-releases/coronavirus-by-the-numbers/
Mar 31, 2020... REHOVOT, ISRAEL—March 31, 2020—Numerical data sometimes reveal facts that are otherwise concealed within an onslaught of information from an overwhelming number of sources. Prof. Ron Milo and research student Yinon Bar-On of the Weizmann Institute of Science’s Department of Plant and Environmental Sciences, together with American colleagues Prof. Rob Phillips of Caltech and Dr. Avi Flamholz of the University of California, Berkeley, have now employed an original research method to organize the flood of coronavirus information in an orderly framework.
Apr 02, 2020... REHOVOT, ISRAEL—April 2, 2020—Along with fever, cough, and shortness of breath, many COVID-19 patients report a temporary loss of sense of smell. It appears that olfactory loss is significantly greater in coronavirus patients compared to the loss often experienced during a cold and, less commonly, in influenza (non-COVID-19) patients. In some countries, such as France, a patient who claims to have sudden onset of olfactory loss will be diagnosed as a coronavirus patient – without even being tested. A similar approach is being considered in the U.K. Based on this data, Weizmann Institute of Science investigators, in collaboration with Israel’s Edith Wolfson Medical Center, developed SmellTracker – an online platform that enables self-monitoring of one’s sense of smell – in order to detect early signs of COVID-19, or in the absence of other symptoms.
Jun 10, 2020... Prof. Eran Segal provides an update on his symptom-tracking questionnaire and how it can help predict the second wave of COVID-19. As he explains, testing is insufficient...
Aug 24, 2020... In this video, Prof. Yonina Eldar (Department of Computer Science and Applied Mathematics; Head, Biomedical Engineering & Signal Processing Center) discusses her development of novel methods for diagnosing COVID.
Sep 18, 2020... CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the flu virus in your body. The device latches onto the virus and deactivates the part of it that breaks into your cells. It is impossibly tiny—smaller than the virus on which it operates—and it can be manufactured, in tremendous quantities, by your own cells. It’s a protein.
Dec 08, 2022... Can the Collective Wisdom of Bugs Help Solve Human Problems?