About Us
Founded in 1944, the American Committee for the Weizmann Institute of Science develops philanthropic support for the Weizmann Institute in Israel, and advances its mission of science for the future of humanity.
Sep 01, 2020... Israeli and German researchers have successfully tested a new treatment for heart repair in pigs, the Weizmann Institute of Science (WIS) in Israel said on Tues ... Read more
https://weizmann-usa.org/news-media/news-releases/profiling-the-covid-19-coronavirus/
Sep 09, 2020... REHOVOT, ISRAEL—September 9, 2020—“Contact tracing” inside infected cells is providing new clues into the workings of SARS-CoV-2, the virus that causes COVID-19 ... Read more
Sep 18, 2020... CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the fl ... Read more
Sep 15, 2020... Israeli researchers say they have taken a stride forward in efforts to “understand the enemy” in the hope of subduing it, after identifying four previously unkn ... Read more
Dec 22, 2021... In this presentation, Emmanuel Levy explains how disease can result from damaged protein, and how protein self-organization can be exploited to produce novel bi ... Read more
https://weizmann-usa.org/news-media/news-releases/building-better-enzymes-by-breaking-them-down/
Jan 13, 2023... REHOVOT, ISRAEL— January 12, 2023—Enzymes have the potential to transform the chemical industry by providing green alternatives to a slew of processes. These pr ... Read more
May 18, 2023... Dr. Moran Shalev Benami discusses her research on the tiniest details of the human brain: proteins. Using cryo-electron microscope (cryoEM), she works to unders ... Read more
https://weizmann-usa.org/news-media/news-releases/surviving-on-an-empty-battery/
Aug 17, 2023... REHOVOT, ISRAEL—August 17, 2023—Every time we make a call, send a text message, or watch a video, some of the energy stored in the cell phone battery is deplete ... Read more
Jan 18, 2024... REHOVOT, ISRAEL—January 18, 2024—Winning a battle requires precise intelligence and unwavering resolve. But when it comes to the battle against cancer, the immu ... Read more
https://weizmann-usa.org/news-media/news-releases/a-discovery-to-set-your-heart-a-knocking/
Aug 26, 2024... REHOVOT, ISRAEL—August 26, 2024—In the late 1960s, three Weizmann Institute of Science researchers developed several protein-like molecules, called copolymers, ... Read more
©2024 American Committee for the Weizmann Institute of Science
