• About Us
    • Overview
    • Education
    • Mission & History
    • Board of Directors
    • The Campus
    • Careers
    • WeizmannNow
  • Our Achievements
    • Overview
    • Cancer
    • Technology
    • Education
    • Our Planet
    • Health & Medicine
    • Physical World
  • Get Involved
    • Overview
    • Partners in Science
    • Estate & Planned Giving
    • Attend an Event
    • Gift Opportunities
  • News & Media
    • Overview
    • News & Media Archive
    • Coronavirus
    • Feature Stories
    • News Releases
    • In The News
    • Video Gallery
    • Ad Campaigns
    • The Weizmann Effect
  • Blog
  • Contact
  • Donate Fighting Coronavirus
Fighting Coronavirus Donate
Fighting Coronavirus Donate
About Us tri
About Us Overview
  • Education
  • Mission & History
  • Board of Directors
  • The Campus
  • Careers
  • WeizmannNow
About Us

Founded in 1944, the American Committee for the Weizmann Institute of Science develops philanthropic support for the Weizmann Institute in Israel, and advances its mission of science for the benefit of humanity.

Our Achievements tri
Our Achievements Overview
  • Cancer
  • Technology
  • Education
  • Our Planet
  • Health & Medicine
  • Physical World
Our Achievements

The Weizmann Institute’s fundamental research has led to discoveries and applications with a major impact on the scientific community and on the quality of life for millions worldwide.

Get Involved tri
Get Involved Overview
  • Partners in Science
  • Estate & Planned Giving
  • Attend an Event
  • Gift Opportunities
Get Involved

Join a community of dedicated people who share the Weizmann Institute’s commitment to shaping a better world through science.

News & Media tri
News & Media Overview
  • News & Media Archive
  • Coronavirus
  • Feature Stories
  • News Releases
  • In The News
  • Video Gallery
  • Ad Campaigns
  • The Weizmann Effect
News & Media

Learn about the Weizmann Institute’s latest groundbreaking discoveries and the American Committee’s activities across the country.

Blog tri
  • The Curiosity Review
Blog

Popular science for the curious-minded: The Curiosity Review brings discovery to life.

Contact

Search Results

  • SEARCH BY KEYWORD
  • SEARCH BY TAG
View Articles by Tag:
  • View Articles by Tag
  • Algorithims (5)
  • Alternative energy (23)
  • Alzheimers (44)
  • Archaeology (37)
  • Artificial intelligence (15)
  • Astrophysics (104)
  • Autism (22)
  • Awards (114)
  • Bacteria (101)
  • Behavior (5)
  • Biochemistry (97)
  • Biofuel (7)
  • Biology (303)
  • Biomolecular sciences (2)
  • Blood (41)
  • Brain (172)
  • Cancer (154)
  • Cancer treatment (125)
  • Central nervous system (9)
  • Chemistry (77)
  • Children (3)
  • Circadian clock (1)
  • Climate change (68)
  • Clinical trials (39)
  • Collaborations (11)
  • Community (275)
  • Computers (70)
  • Copaxone (12)
  • Coronavirus (6)
  • Culture (355)
  • Diabetes (32)
  • Earth (68)
  • Education (150)
  • Environment (87)
  • Enzymes (28)
  • Evolution (87)
  • Fertility (17)
  • Fungus (1)
  • Genetics (104)
  • Genomics (2)
  • Heart (4)
  • Heart disease (2)
  • Humanity (80)
  • Immune system (148)
  • Immunology (2)
  • Immunotherapy (34)
  • Inflammation (17)
  • Leadership (106)
  • Leukemia (12)
  • Materials (43)
  • Mathematics (61)
  • Medicine (76)
  • Memory (39)
  • Mental health (56)
  • Metabolism (50)
  • Microbiome (6)
  • Molecular cell biology (3)
  • Molecular genetics (57)
  • Multiple sclerosis (11)
  • Nanoscience (32)
  • Nature (1)
  • Neuroscience (202)
  • Nutrition (71)
  • Optics (29)
  • Organs (9)
  • Parkinsons (10)
  • Personalized medicine (3)
  • Philanthropy (140)
  • Physics (134)
  • Plants (54)
  • Proteins (95)
  • Quantum computer (2)
  • Quantum physics (1)
  • Quantum theory (33)
  • Robots (7)
  • Security (21)
  • Senses (115)
  • Sensors (8)
  • Smoking (1)
  • Solar power (17)
  • Space (105)
  • Stem cells (45)
  • Technology (203)
  • Vaccine (39)
  • Virus (132)
  • Water (39)
  • Weather (1)
  • Women (111)
  • World hunger (16)
Filter by Time:
  • All
  • Past Day
  • Past Week
  • Past Month
  • Past Year
  • Past Three Years
Clear Filters

95 results for Proteins

Israeli, German Scientists Successfully Test New Heart-Repair Treatment in Pigs
Israeli, German Scientists Successfully Test New Heart-Repair Treatment in Pigs

https://weizmann-usa.org/news-media/in-the-news/israeli-german-scientists-successfully-test-new-heart-repair-treatment-in-pigs/

Sep 01, 2020... Israeli and German researchers have successfully tested a new treatment for heart repair in pigs, the Weizmann Institute of Science (WIS) in Israel said on Tuesday.
In a study, published in the journal Circulation, WIS researchers, in collaboration with the Technical University of Munich, found that a human protein called Agrin could limit scarring in the heart muscle.
This means that Agrin might serve as an effective therapy after heart attacks, promoting heart repair and helping to prevent chronic heart failure, it said.

TAGS: Biology, Proteins, Organs

Profiling the COVID-19 Coronavirus
Profiling the COVID-19 Coronavirus

https://weizmann-usa.org/news-media/news-releases/profiling-the-covid-19-coronavirus/

Sep 09, 2020... REHOVOT, ISRAEL—September 9, 2020—“Contact tracing” inside infected cells is providing new clues into the workings of SARS-CoV-2, the virus that causes COVID-19. A research team at the Weizmann Institute of Science and the Israel Institute for Biological Research, in Ness Ziona, Israel, used the contacts between the virus’s genetic material and the cells’ protein-producing machinery to bring to light details of the viral protein-coding segments and the new – and potentially important – proteins they create. The findings of this research, published in Nature, could lead to better diagnostics or new treatments, and help to explain what makes this virus so skilled in the process of infection.

TAGS: Molecular genetics, Virus, Proteins

Scientists Advance on One of Technology’s Holy Grails
Scientists Advance on One of Technology’s Holy Grails

https://weizmann-usa.org/news-media/in-the-news/scientists-advance-on-one-of-technology-s-holy-grails/

Sep 18, 2020... CIEQSFTTLFACQTAAEIWRAFGYTVKIMVDNGNCRLHVC: these forty letters are a set of instructions for building a sophisticated medical device designed to recognize the flu virus in your body. The device latches onto the virus and deactivates the part of it that breaks into your cells. It is impossibly tiny—smaller than the virus on which it operates—and it can be manufactured, in tremendous quantities, by your own cells. It’s a protein.

TAGS: Technology, Virus, Proteins, Algorithims

New Coronavirus Proteins Found by Israeli Lab, Potentially Helping Drug Efforts
New Coronavirus Proteins Found by Israeli Lab, Potentially Helping Drug Efforts

https://weizmann-usa.org/news-media/in-the-news/new-coronavirus-proteins-found-by-israeli-lab-potentially-helping-drug-efforts/

Sep 15, 2020... Israeli researchers say they have taken a stride forward in efforts to “understand the enemy” in the hope of subduing it, after identifying four previously unknown proteins that people produce as a result of coronavirus infection.
They have also identified 19 peptides, short chains of amino acids, that had not previously been identified in the bodies of infected people.
“We now know the enemy better,” Noam Stern-Ginossar, a scientist behind the peer-reviewed study just published in Nature, told The Times of Israel.

TAGS: Immune system, Virus, Proteins

Playing LEGO with Proteins: Principles of Protein Assembly in Cells
Playing LEGO with Proteins: Principles of Protein Assembly in Cells

https://weizmann-usa.org/news-media/video-gallery/playing-lego-with-proteins-principles-of-protein-assembly-in-cells/

Dec 22, 2021... In this presentation, Emmanuel Levy explains how disease can result from damaged protein, and how protein self-organization can be exploited to produce novel biomaterials. Levy combines experimental data with a database of protein structural information that helps him to predict, browse, and curate the structural features within a protein that govern the formation of quaternary structures to reveal new methods by which proteins operate within cells.

TAGS: Proteins

First … 1 2 3 4 5 6 7 8 9 10 Last
Back
SHARE

Our Achievements

Learn more about remarkable Weizmann Institute achievements that are enhancing and transforming our lives.

Learn More

Support Our Flagship Projects

Help us accelerate exciting initiatives in three forward-looking fields: neuroscience, physics, and artificial intelligence.

Learn More

Newsletter

Get the latest news and breakthroughs from the Weizmann Institute of Science.

About Us
  • Education
  • Mission & History
  • Board of Directors
  • The Campus
  • Careers
  • WeizmannNow
Our Achievements
  • Cancer
  • Technology
  • Education
  • Our Planet
  • Health & Medicine
  • Physical World
Get Involved
  • Partners in Science
  • Estate & Planned Giving
  • Attend an Event
  • Gift Opportunities
News & Media Blog: Curiosity Review Fighting Coronavirus Donate Now Contact Us
Privacy Policy Gift Acceptance Policy Financial Information

©2022 American Committee for the Weizmann Institute of Science

Charity Navigator

FOR THE FOURTH CONSECUTIVE YEAR